PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.25542s0202.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 302aa    MW: 34552.8 Da    PI: 4.9104
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.25542s0202.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.6e-1859112356
                           --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           k++++  +q+++Le+ Fe ++++  e++++LA++lgL+ rqV vWFqNrRa++k
  Bostr.25542s0202.1.p  59 KKRRLRVDQVKALEKNFELENKLEPERKTKLAQELGLQPRQVAVWFQNRRARWK 112
                           45578899*********************************************9 PP

2HD-ZIP_I/II1292e-4158150193
           HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                           ekkrrl  +qvk+LE++Fe e+kLeperK++la+eLglqprqvavWFqnrRAR+ktkqlE+dy  Lk++yd+l+++ ++L++++++L +
  Bostr.25542s0202.1.p  58 EKKRRLRVDQVKALEKNFELENKLEPERKTKLAQELGLQPRQVAVWFQNRRARWKTKQLESDYGILKSQYDSLRHNFDSLRRDNDSLLQ 146
                           69*************************************************************************************99 PP

           HD-ZIP_I/II  90 elke 93 
                           e+++
  Bostr.25542s0202.1.p 147 EISK 150
                           9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.97E-1852116IPR009057Homeodomain-like
PROSITE profilePS5007116.81154114IPR001356Homeobox domain
SMARTSM003891.1E-1657118IPR001356Homeobox domain
PfamPF000461.4E-1559112IPR001356Homeobox domain
CDDcd000862.52E-1559115No hitNo description
Gene3DG3DSA:1.10.10.601.2E-1962121IPR009057Homeodomain-like
PRINTSPR000317.0E-68594IPR000047Helix-turn-helix motif
PROSITE patternPS00027089112IPR017970Homeobox, conserved site
PRINTSPR000317.0E-694110IPR000047Helix-turn-helix motif
PfamPF021833.7E-16114155IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MKRLSSSDSE CGLISTSTDE QSPRGYGSKY QSMLEGYEED ATLIEEYSGN HHQMGLSEKK  60
RRLRVDQVKA LEKNFELENK LEPERKTKLA QELGLQPRQV AVWFQNRRAR WKTKQLESDY  120
GILKSQYDSL RHNFDSLRRD NDSLLQEISK IKAKINGEED NNNNNKATME SVKEEEVSLP  180
EKFQKTDSTP SSPPQFLEHS TDFNYRRSFT DHRDLLPNST VVDAGSSDSC DSSAVLNDET  240
SSDNRRVTPP AKVTGKSFLQ YVKMEQTEDH DDFLSGEEAC GFFSDEQPPS LHWYSASDHW  300
T*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1106114RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3706200.0AF370620.1 Arabidopsis thaliana homeodomain-like protein (T5J17.230) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010431992.10.0PREDICTED: homeobox-leucine zipper protein ATHB-16
SwissprotQ940J10.0ATB16_ARATH; Homeobox-leucine zipper protein ATHB-16
TrEMBLD7M9I70.0D7M9I7_ARALL; ATHB16
STRINGAT4G40060.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54528143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.11e-168homeobox protein 16